PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000358.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 1079aa    MW: 120355 Da    PI: 4.9382
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000358.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK27.84.9e-09682721443
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkR 43 
                               ++ +++++ F ++++dAAk L+v++++ Kr C  +GI R
  Itr_sc000358.1_g00008.1 682 GVTRKVVEQLFGKSLHDAAKALKVSPSTFKRPCLDFGITR 721
                              578999********************************99 PP

2RWP-RK49.21e-15809852548
                   RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                              i+ + l++ F  +  dAAk+L+v++++LKr+CR +GI+RWP  k
  Itr_sc000358.1_g00008.1 809 ITRQALEQLFGNSRDDAAKTLKVSTSTLKRACRDFGINRWPNHK 852
                              8999*************************************877 PP

3RWP-RK39.11.5e-12897940548
                   RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                              +s++ +++   ++  +AAk+L v++++ Kr+CR +GI+RWP  k
  Itr_sc000358.1_g00008.1 897 MSVKFVQQLICKSSDAAAKTLTVSTSTFKRACRDFGINRWPNHK 940
                              66778899999999***************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF020421.1E-7683721IPR003035RWP-RK domain
PROSITE profilePS5151912.423787881IPR003035RWP-RK domain
PfamPF020421.3E-14809852IPR003035RWP-RK domain
PROSITE profilePS5151910.216880965IPR003035RWP-RK domain
PfamPF020422.2E-10900940IPR003035RWP-RK domain
SuperFamilySSF542771.73E-159881074No hitNo description
Gene3DG3DSA:3.10.20.2404.9E-169921076No hitNo description
SMARTSM006662.0E-139951077IPR000270PB1 domain
PROSITE profilePS5174517.179951077IPR000270PB1 domain
PfamPF005645.0E-139961075IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1079 aa     Download sequence    Send to blast
MALVENDDAS SLIDPSAENL PSSGLAEQAQ PPPYVVCPSP TRWLFNHGGL TWNPVTEMGT  60
AENASAAALT ESEMSEEGET SVVHHLERDS DNHSECDLLL DMAGGMMMSL SPPRPRMNFS  120
GEEAALFLSP NFHAHMGMGG GMMMSMSPPR MNYFSLPSGD SIDPYRLWNF ADHSEVQELE  180
NMKGMMMRPT WKQQQQQLCA LGQNQSLGIW AAENMGLGGT VQTSDDDSVN NVDEWFQLAG  240
GMNYTLPSDD SHSLGGSFDP YRLRDDGEFS VVHDVNPVVE LAHLYVVVGI ELFFPEKVSQ  300
DMAIKLFECL EMGTILPVEY ISVVSWENKY IVVDLKAESW GGIMEQISVD YPQISDQIDE  360
QVYYIRQLPP LIICCLEEVE FEIEVEEFKC NFCIPKTLRS NSSLDSLILL GSCKPDLPGV  420
TPCLLSLECL CQNMVIELGN GEQIIIMRLN VKQAAAYLEV DFSSEKNYAV CSSQALELES  480
RGGMIMERIS VSHRWQFAFC SKTHRWNVVL ELLDVVVRQL LYLGTNNYSF GISVNDDRSS  540
SSSSVNTKMH SLLYFERTFL EMQHLNSLER HFLDHFERLV QTGVLELLSG EEIKLRYLQE  600
EEEEVGTASK KNHSVSILPA LLEAECRRGG NGMMQLDSPC EGHIPKSSVT DEERNVVGLK  660
RIDAIGNISK KKDIIWWQKD HGVTRKVVEQ LFGKSLHDAA KALKVSPSTF KRPCLDFGIT  720
RRSLEEVGTA SEENHTAHIW PALEAHYNAA GTGGMLLQHE DSSSEPHIPE SSATNNVVEL  780
NNSIDNAKGG NSSSEKTNTV SRWEKDYGIT RQALEQLFGN SRDDAAKTLK VSTSTLKRAC  840
RDFGINRWPN HKGKRPNCSL NQKQDIQAVK KHKGIPPCPA LPPLEGTNTS QCNSTIMSVK  900
FVQQLICKSS DAAAKTLTVS TSTFKRACRD FGINRWPNHK GKMPNFSLNQ KQDVQAVKRH  960
KGIQPCPALP PEEATTTLHL PPEEATTTTL QGNSAMSVKA TYEDNTIRFP LPSSSTIKYL  1020
EEQLETRFKI SLENFSILYQ DEEADWISLT CDSDLMYGMD VLRSSGKTVV KMKINPNFG
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10406515
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.19e-23Nin-like family protein